IGF-1 LR3 & IGF-1 DES

Špecifikácia IGF-1 LR3

igf1-5 lr3

  • Hmotnosť:
    9117.50 g/mol
  • Vzorec:
    C400H625N111O115S9
  • Sekvencia:
    H-Met-Phe-Pro-Ala-Met-Pro-Leu-Ser-Ser-Leu-Phe-Val-Asn-Gly-Pro-Arg-Thr-Leu-Cys-Gly-Ala-Glu-Leu-Val-Asp-Ala-Leu-Gln-Phe-Val-Cys-Gly-Asp-Arg-Gly-Phe-Tyr-Phe-Asn-Lys-Pro-Thr-Gly-Tyr-Gly-Ser-Ser-Ser-Arg-Arg-Ala-Pro-Gln-Thr-Gly-Ile-Val-Asp-Glu-Cys-Cys-Phe-Arg-S
  • CAS:
    946870-92-4

Špecifikácia IGF-1 DES

igf1-6 des

  • Hmotnosť:
    7371.40 g/mol
  • Vzorec:
    C319H501N91O96S7
  • Sekvencia:
    H-Thr-Leu-Cys-Gly-Ala-Glu-Leu-Val-Asp-Ala-Leu-Gln-Phe-Val-Cys-Gly-Asp-Arg-Gly-Phe-Tyr-Phe-Asn-Lys-Pro-Thr-Gly-Tyr-Gly-Ser-Ser-Ser-Arg-Arg-Ala-Pro-Gln-Thr-Gly-Ile-Val-Asp-Glu-Cys-Cys-Phe-Arg-Ser-Cys-Asp-Leu-Arg-Arg-Leu-Glu-Met-Tyr-Cys-Ala-Pro-Leu-Lys-Pro-A
  • CAS:
    112603-35-7
INFORMÁCIEHLAVNÉ ÚČINKYDÁVKOVANIE A APLIKÁCIAVEDĽAJŠIE ÚČINKYODKAZY

INFORMÁCIE O IGF-1

igf1-3

Inzulínu podobný rastový faktor 1 (IGF-1), nazývaný aj Somatomedin C, sa radí medzi polypeptidy. Inzulínu podobné rastové faktory (IGF) sú mitogénne polypeptidové rastové faktory, ktoré stimulujú proliferáciu a prežívanie rôznych typov buniek, vrátane buniek svalového, kostného a chrupavkového tkaniva in vitro. IGF sú produkované prevažne v pečeni, no v určitých časoch dochádza k ich tvorbe aj v iných tkanivách. IGF patria do rodiny inzulínových génov, kam patrí aj inzulín a relaxín. IGF majú podobnú stavbu a funkciu ako inzulín, no majú oveľa silnejší stimulujúci účinok na rast ako inzulín. Expresia IGF-II je ovplyvnená placentárnym laktogénom, zatiaľ čo expresia IGF-I je regulovaná rastovým hormónom. Signalizácia IGF-I aj IGF-II sa uskutočňuje prostredníctvom tyrozínkinázového receptora typu I (IGF-IR), ale signalizácia IGF-II môže prebiehať aj prostredníctvom IGF-II/manóza-6-fosfátového receptora. Proteolytické spracovanie neaktívnych prekurzorov proteínov, ktoré obsahujú N-terminálne a C-terminálne propeptidové oblasti, generuje zrelé IGF. Rekombinantný ľudský IGF-I a IGF-II sú  globulárne proteíny. IGF-I obsahuje 70 aminokyselín a IGF-II obsahuje 67 aminokyselín, pričom oba obsahujú 3 intramolekulárne disulfidové väzby. Somatomedíny tvoria triedu polypeptidov, ktoré zohrávajú kľúčovú úlohu v preadolescentnom raste cicavcov. Expresia IGF-I je regulovaná rastovým hormónom a sprostredkováva postnatálny rast, zatiaľ čo IGF-II je pravdepodobne indukovaný placentárnym laktogénom počas prenatálneho vývoja. Syntetický analóg IGF-1 Mecasermin (Mekasermín) sa používa na liečbu porúch rastu detí a dospievajúcich od 2 do 18 rokov, ktorí sú na svoj vek príliš nízki, pretože ich telo nevytvára dostatok IGF-1. Tento stav sa označuje ako primárna deficiencia IGF-1. Mekasermín (Mecasermin) je vlastne inzulínu podobný rastový faktor-1 (IGF-1), ktorý sa podobá na IGF-1 produkované ľudským telom. Terapeutické podávanie spolu s neurotrofnými proteínmi (IGF-I) je spojené s potenciálnym zvrátením degenerácie axónov motorických neurónov miechy pri niektorých typoch periférnej neuropatie. IGF1/IGF-I môže pôsobiť ako fyziologický regulátor transportu [1-14C]-2-deoxy-D-glukózy (2DG) a syntézy glykogénu v osteoblastoch. IGF1/IGF-I stimuluje transport glukózy v osteoblastických bunkách potkanov (PyMS) a je účinný pri oveľa nižších koncentráciách než inzulín, a to nielen pokiaľ ide o glykogén a syntézu DNA, ale tiež s ohľadom na zvýšené vychytávanie glukózy. Poruchy v IGF1/IGF-I spôsobujú nedostatok inzulínu podobného rastového faktora I (nedostatok IGF1), čo je autozomálne recesívna porucha charakterizovaná retardáciou rastu, percepčnou hluchotou a mentálnou retardáciou.

Špecifikácia IGF-1

Molekulová hmotnosť: 7.5 kDa

Molekulový vzorec: C331H512N94O101S7

Molekulová sekvencia: GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQ TGIVDECCFRSCDLRRLEMYCAPLKPAKSA

CAS: 67763-96-6

 

Špecifikácia Mecasermin

Molekulová hmotnosť: 7648.67 g/mol

Molekulový vzorec: C331H512N94O101S7

Molekulová sekvencia: GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQ TGIVDECCFRSCDLRRLEMYCAPLKPAKSA

CAS: 68562-41-4

HLAVNÉ ÚČINKY IGF-1

IGF-1 je endokrinný hormón, ktorý je produkovaný v pečeni. Produkciu IGF-1 v tele stimuluje ľudský rastový hormón (RH), ktorý je jeho metabolitom / prekurzorom, a konvertuje v pečeni na spomínaný IGF-1. V ľudskom organizme existuje mnoho rôznych typov buniek, ktoré sú vybavené receptorom pre naviazanie IGF-1. Vďaka tomu je IGF-1 dobrý protagonista pri zacielení na tkanivá s cieľom urýchliť komunikáciu medzi bunkami (rast), alebo v procese autokrinnej bunkovej signalizácie, ktorá uľahčuje bunkové delenie. IGF-I Jeho receptor (receptor typu I) se nachádza na bunkovej membráne a podobá se inzulinovému receptoru (dva alfa a dva beta reťazce). Väzbou IGF-I na receptory typu I dochádza k stimulaci tyrosinkinázy a následnej autofosforylaci tyrosinových molekul, čo vedie k bunkovej diferenciaci alebo k deleniu (príp. k obidvom javom). IGF-I receptory sú regulované k zníženiu ich množstva pri zvýšenej koncentrácii IGF-I. Naopak znížená koncentrácia IGF-I vedie k množeniu IGF-I receptorov. Nejdôležitejším miestom pre syntézu IGF-I je pečeň (je však produkovaný aj inými orgánmi, napr. chrupavkou). Hormón sa dostáva k susedným bunkám, ktoré ovplyvňuje parakrinným spôsobom (príp. je autokrinným faktorom, který ovplyvňuje bunku z ktorej pochádza) a preto nemusí mať najväčšie účinky v krvi. IGF-1 má predovšetkým veľmi silné anabolické účinky a stimuluje metabolizmus aminokyselín v tele. Okrem toho zvyšuje syntézu proteínov, zvyšuje syntézu RNA, podporuje metabolizmus tukov a transport glukózy, znižuje odbúravanie bielkovín. V detstve zohráva dôležitú úlohu v raste a u dospelých má anabolické účinky.

 

igf1-4


„Enviromental cues“ – Podnety z prostredia

„Brain“ – Mozog

„Growth hormone“ – Rastový hormón

„Liver“ – Pečeň

„Insulin“ – Inzulín

„Nutrition/Food“ – Výživa/Jedlo

„Target tissues“ – Cieľové tkanivá

„Growth“ – Rast

 


Zjednodušene povedané, zvýšenie celkovej hmotnosti vďaka IGF-1 (všetky analógy) nie je spôsobené zvýšením hmotnosti vody. To znamená, že dosiahnuté celkové zvýšenie hmotnosti bude predstavovať nárast čistej svalovej hmoty. Je známe, že užívanie androgénnych anabolických steroidov (AAS) je spojené s nepríjemnými vedľajšími účinkami a zadržiavaním tekutín. Počas užívania všetkých variant analógov IGF-1 sa dosiahne rast svalovej hmoty bez zadržiavania vody a ostatných bežných vedľajších účinkov AAS. Najdôležitejším faktorom je schopnosť IGF-1 dosiahnuť hyperpláziu, čo znamená, že sa v skutočnosti zvýši počet buniek v svalovom tkanive. Hyperplazia je vo fyziológii ponímaná ako proces, pri ktorom nastáva zväčšenie orgánov vďaka zmnoženiu buniek. V prípade svalovej hmoty počas procesu hyperplazie nastane rast svalovej hmoty vďaka tomu, že sa v zaťažovanom svale tvoria nové svalové vlákna. Pomocou IGF-1 môžete prakticky dosiahnuť väčšiu hustotu a veľkosť svalovej hmoty na genetickej úrovni. AAS pomôžu rastu svalov prostredníctvom hypertrofie a okrem zhrubnutia svalových vlákien spôsobujú aj spomínané masívne zadržiavanie tekutín vo svalovej bunke. Hypetrofia je proces zmnoženia kontraktilných bielkovín (aktínu a myozínu), čo vedie k zhrubnutiu svalových vlákien. IGF-1 má množstvo daľších pozitívnych účinkov ako napr. regulácia množstva tuku pre získavanie energie (čo má za následok odbúravanie tuku), protistarnúci účinok, zvýšenie metabolizmu živín (syntéza bielkovín) a zvýšenie regeneračnej funkcie nervového tkaniva.  Rastový hormón je v skutočnosti prekurzorom IGF-1. Rastový hormón priamo nespôsobuje nárast svalovej hmoty, ale nepriamo spôsobuje rast svalov tým, že vyšle signál pre uvoľňovanie hormónu IGF-1. Najčastejšie užívané analógy IGF-1 sú Mecasermin (Mekasermín), IGF-1 LR3 (LONG R3 IGF-1) a IGF-1 DES (DES 1-3 IGF). Samotné IGF-1 (Mecasermin) má veľmi krátky polčas rozpadu (10-20 minút). V dôsledku toho po aplikácii v organizme rýchlo degraduje. To je dôvod vzniku modifikácie IGF-1 v podobe jeho analógu IGF-1 LR3. Druhý spomínaný analóg IGF-1 je nazývaný IGF-1 DES a predstavuje jeho skrátenú a vysoko účinnú verziu. Oba varianty sú podobné kmeňu, od ktorého boli odvodené. Odlišujú sa však účinkami, čo im umožňuje fungovať špecifickými spôsobmi. Ľudský rastový hormón Somatropín (rHGH) môže byť veľmi drahý a aby sa dosiahol rast svalov, odporúča sa kombinovať s Inzulínom alebo AAS. Analógy IGF-1, ako Mecasermin, LR3 a DES (ktoré sa môžu uživať aj ako samostatné liečivá) sú zdravšou a lacnejšiou alternatívou pre užívateľov, ktorí chcú vidieť nielen pevnú obnovu poškodeného tkaniva ale ja rast čistej svalovej hmoty. V prípade kombinácie týchto peptidov s AAS , endogénnym (GHRP a GHRH peptidy) alebo exogénnym (rHGH) rastovým hormónom je môžné dosiahnuť extrémny nárast a skvalitnenie svalovej hmoty spolu s výraznou redukciou tuku už pri pomerne nízkom dávkovaní kombinovaných látok.


igf1-2 igf1-1

INFORMÁCIE O IGF-1 LR3


 

Polypeptid Long R3 inzulínu podobný rastový faktor I (IGF-1 LR3) je 83 aminokyselinový analóg IGF-I, ktorý obsahuje kompletnú sekvenciu IGF-1, ale so substitúciou arginínu (Arg) za kyselinu glutámovú (Glu) v polohe 3 a s predĺžením o 13 aminokyselín. Táto zmena sekvencie spôsobila, že IGF-1 LR3 (LONG R3 IGF-1)  sa neviaže na proteíny a má oveľa dlhší polčas rozpadu, približne 20-30 hodín. Analóg IGF-1 bol vyrobený za účelom zvýšenia biologickej aktivity IGF peptidu. „IGF“ je skratka pre inzulínu podobný rastový faktor. Medzi jeho najpozítivnejšie účinky patrí zvýšený transport aminokyselín do buniek, zvýšený transport glukózy, zvýšená syntéza bielkovín a znížená degradácia proteínov. Keď je IGF aktívny, v rôznych typoch tkanív má odlišný účinok. V svalových bunkách stimuluje proteíny a súvisiace bunkové zložky. Syntéza proteínov sa zvyšuje spolu s absorpciou aminokyselín. V tukovom tkanive IGF-1 LR3 mobilizuje tuk ako zdroj energie. V netukovom tkanive IGF-1 LR3 zabraňuje inzulínu transportovať glukózu cez bunkové membrány. V dôsledku toho musia bunky prejsť na získavanie energie spaľovaním tukov. IGF-1 LR3 buduje nové svalové tkanivo tým, že podporuje retenciu dusíka a syntézu bielkovín. To spôsobuje rast svalov prostredníctvom hyperplázie (zvýšenie počtu svalových buniek) a mitogenézy (rast nových svalových vlákien). IGF-1 LR3 teda nielen zväčšuje svalové vlákna, ale zároveň zvyšuje ich počet. IGF teda môže zmeniť genetické predpoklady v súvislosti so svalovým tkanivom a počtom buniek. IGF zvyšuje a diferencuje počet a typ existujúcich buniek.  Štúdie na transgénnych a knockoutovaných myšiach ukázali, že môže regulovať ich vývoj a rast. Zohráva dôležitú úlohu ako regulátor G1 až S fázy bunkového cyklu. Pri aplikácii v kultúrach kardiomyocytov R3 spôsobil veľké zvýšenie expresie nukleárneho antigénu proliferujúcich buniek a niektorých cyklínov zapojených do bunkovej progresie a do značenia bromodeoxyuridiénom (BrdU) (Kajstura a kol., 1994). Iné účinky na bunkové línie zahŕňajú zvýšené prežívanie buniek, inhibíciu apoptotických dráh, kultivačnú životnosť a zvýšenú rekombináciu produkcie proteínov (Fang a kol., 1997). V inej štúdii viedla aplikácia LR3 IGF-1 k trojnásobne až päťnásobne vyššiemu vychytávaniu bromdeoxyuridínu myocytmi. Zistilo sa tiež, že účinky IGF-1 LR3 boli blokované značením s EKR a P13K, čo úplne znemožnilo vychytávanie BrdU. Okrem toho sa zistilo, že IGF-1 R 3 stimuluje delenie kardiomyocytov in vivo (Sundgren a kol., 2003). Predpokladá sa, že IGF-1-Long R3 je účinnejší ako IGF-1 vzhľadom na jeho nízku väzbovú kapacitu so všetkými známymi IGF väzbovými proteínmi (Tomas a kol., 1995). V inom výskume sa skúmali účinky LR3-IGF-1 na somatotropnú os podávaním rôznych množstiev látky (plazmatické hladiny IGF-1 a 2, IGFBP). Zistilo sa, že plazmatická hladina Long-R3 sa zvýšila po subkutánnom podaní, no nie po orálnom podaní. Navyše, LR3 znížil hladinu natívneho IGF-1 u teliat, ktorým bolo injekciou aplikované rHGH, avšak LR3 zvýšil koncentráciu IGF-II, ak bol podaný subkutánne spolu s LR3. Parenterálne podanie Long R3 IGF-1 znížilo koncentráciu rastového hormónu, no nemalo vplyv na sekrečný systém. Taktiež sa zistilo, že somatotropná os je v zásade aktívna u novorodených teliat a môže byť ovplyvnená výživou, rastovým hormónom a Long R3 IGF-1 (IGF-1 LR3) (Hammon a Blum 1997).


 

HLAVNÉ ÚČINKY IGF-1 LR3


IGF-1 LR3 (Long R3) je oveľa účinnejší ako samotné IGF-1. Celkovo sa tento analóg považuje za najúčinnejšiu formu IGF-1. Táto zlúčenina bola chemicky upravená tak, aby sa zabránilo jej väzbe na proteíny v ľudskom tele a zvýšil sa jej polčas na približne 20 až 30 hodín. Počas tejto doby pôsobenia jeho cirkulácie  v organizme sa bude viazať na receptory a aktivovať bunkovú komunikáciu, čo spôsobí zvýšenie rastu svalov a spaľovania tukov. LR3 bráni glukóze vstupovať do buniek a tým dosahuje lepšie spaľovanie tukov a sacharózy. Lokálne intramuskulárne injekcie do konkrétnych svalových skupín nie sú nutné, pretože IGF-1 LR3 sa bude počas cirkulácie v tele viazať na všetky svalové bunky po celú dobu jeho dlhého polčasu rozpadu. Keď je IGF-1 LR3 aktívny, má rôzne účinky na svalové tkanivo. Zohráva dôležitú úlohu v obnove svalovej hmoty. IGF-1 LR3 stimuluje zväčšenie a diferenciáciu kmeňových buniek. IGF-1 LR3 zvyšuje aktivitu satelitných buniek, svalovej DNA, obsah svalových proteínov, svalovú hmotu a svalový prierez. Význam IGF-1 LR3 spočíva v tom, že všetky jeho zjavné účinky indukujú rast svalovej hmoty. Tieto účinky sa ešte zvýraznia v kombinácii so silovým tréningom. Tvorba proteínov stúpa so zvyšujúcou sa absorpciou aminokyselín ako zdroja energie. Zlepšuje využívanie tukov ako zdroja energie. V netukovom tkanive IGF-1 LR3 zabraňuje inzulínu prenášať glukózu cez bunkové membrány. V dôsledku toho musia bunky získavať energiu spaľovaním tukov. IGF-1 LR3 taktiež napodobňuje pôsobenie inzulínu v ľudskom tele. Snáď najpozoruhodnejším vplyvom IGF-1 LR3 na ľudské telo je jeho schopnosť vyvolať hyperpláziu, t.j. delenie buniek. Hypertrofia je to, čo nasleduje po silovom tréningu – zvýšenie veľkosti svalových buniek. Dospelí ľudia majú fixný počet svalových buniek, ktoré sa môžu zväčšiť cvičením, avšak počet svalových buniek sa nezvyšuje. S týmto prípravkom však môžete indukovať hyperpláziu, ktorou sa počet svalových buniek vo svale zvýši. Výskumné štúdie ukazujú, že pri silovom tréningu sa nové bunky vyvíjajú rýchlejšie a stávajú sa silnejšími a hustejšími.


 

INFORMÁCIE O IGF-1 DES


IGF-1 DES (DES 1-3 IGF)  je štiepenou formou IGF-1 a obsahuje aminokyseliny 4-70. Vďaka tejto štruktúre sú účinky proteínu IGF-1 zosilnené v stabilnejšej forme molekuly peptidového fragmentu DES 1-3 inzulínu podobného rastového faktoru 1. IGF-1 DES, alebo rastový faktor podobný inzulínu DES, pochádza z IGF-1 rodiny peptidov, ktorá zohráva dôležitú úlohu v raste a vývoji cicavcov. IGF1 vykazuje mnohé rast stimulujúce účinky rastového hormónu a IGF-1 DES, hoci kratšie, rovnaké množstvo fyzických zmien fyziologicky alterujúceho proteínu.. Skoršie štúdie ukázali, že rastový hormón priamo nestimuluje zabudovávanie sulfátov do chrupavky, ale pôsobí skôr cez sérový faktor nazývaný „sulfatačný faktor“, ktorý sa stal neskôr známym ako „somatomedín“ alebo IGF-1 a nedávno bol skrátený na DES IGF-1.

 


HLAVNÉ ÚČINKY IGF-1 DES

 

DES 1-3 IGF (IGF-1 DES) je kratšou verziou reťazca IGF-1 a približne 10 krát silnejšou ako samotný IGF-1. Polčas rozpadu IGF-1 DES je 20 až 30 minút, čo znamená, že sa jedná o veľmi krehký reťazec. Na základe uvedenej skutočnosti sa odporúča aplikovať prostredníctvom intramuskulárnej injekcie len lokálne v mieste, kde je najviac požadované dosiahnuť rast svalov. Zjednodušene povedané, je výhodnejšie ho aplikovať pre jeho lokálny účinok rastu na konktrétnom mieste ako pre účinok celkového rastu svalov celého  tela. IGF-1 DES sa viaže na receptory deformované kyselinou mliečnou, ktorá je často prítomná v priebehu cvičenia. To umožňuje, aby sa DES pripojil k mutovanému receptoru a vyslal signál pre rast tkaniva v priebehu cvičenia. IGF-1 DES sa môže užívať dlhšie a častejšie ako IGF-1 LR3.

 

DÁVKOVANIE A APLIKÁCIA PEPTIDU

Peptid IGF-1 LR3 sa odporúča dávkovať raz krát denne v množstve 50 – 150 mcg pre jednotlivú dávku. Dávka sa môže aplikovať v čase po prebudení, aspoň 4 hodiny pred tréningom, aspoň 8 hodiny po tréningu alebo pred spaním. Z dôvodu vzniku desenzibilizácie je odporúčaná doba úžívania 4 týždňe, po ktorých nasledujú 2 týždne odpočinku. Peptid sa môže aplikovať aj formou intramuskulárnej injekcie (aplikácia do svalu), ale odporúčaná forma aplikácie je subkutánna injekcia (podkožná aplikácia) pomocou inzulínovej striekačky. Peptid IGF-1 DES sa odporúča dávkovať 1 – 3 krát denne v množstve 50 – 150 mcg pre jednotlivú dávku. Dávka sa môže aplikovať v čase po prebudení, pred tréningom do konkrétnych cieľových oblastí (najdôležitejšia dávka) alebo pred spaním. Z dôvodu krátkeho polčasu rozpadu nehrozí riziko desenzibilizácie a preto nie je potrebné užívanie peptidu cyklovať a tým obmedzovať dobu jeho užívania. Peptid sa môže aplikovať aj formou subkutánnej injekcie (podkožná aplikácia), ale odporúčaná forma aplikácie je lokálna intramuskulárna injekcia (aplikácia do svalu) pomocou inzulínovej striekačky priamo do svalov, v ktorých je požadovaný rast. IGF-1 LR3 a IGF-1 DES nie sú špecifické pre pohlavie (pre ženy aj mužov platia rovnaké dávky) a tiež nie sú dostupné v biologickej forme na orálne užívanie, keďže ide o peptidy, ktoré by podľahli hydrolýze a v žalúdku by sa rozpadli na samostatné aminokyseliny. Z uvedeného dôvodu sa využíva injekčné podanie. Aplikovať sa musia nalačno (po 1-3 hodinách od posledného jedla) a po aplikáci peptidov je potrebné nepríjmať potravu aspoň ďalších 20-30 minút.


TYP DÁVKY MNOŽSTVO PRE DÁVKU
Minimálna dávka 50 mcg
Odporúčaná dávka 100 mcg
Vysoká dávka 150 mcg

 

VEDĽAJŠIE ÚČINKY PEPTIDU

Je potrebné uviesť fakt, že vysoké dávky IGF-1 môžu spôsobovať miernu hypoglykémiu. Jej intenzita sa však ani zďaleka nepribližuje k úrovni spôsobenej aplikáciou Inzulínu. Pre zamedzenie vzniku uvedeného vedľajšieho účinku je potrebné dodržiavať odporúčané dávkovanie. V skutočnosti neexistujú žiadne ďalšie významné vedľajšie účinky uvedených peptidov, ani alergické reakcie, interakcie, alebo dokonca závislosť. Počas užívania peptidov IGF-1 LR3 a IGF-1 DES neboli zaznamenané časté vedľajšie príznaky niektorých peptidov, podobné chrípke. Podľa užívateľov toto prirovnanie predstavuje nežiadúce efekty ako napr. letargia, závraty a bolesť hlavy, ktoré sú spojené s užívaním pomernej väčšiny peptidov.  Niektorý užívatelia uvádzajú, že po aplikácii peptidov pociťovali svrbenie v mieste aplikácie. Posledný uvedený nežiadúci účinok môže byť len počiatočná reakcia organizmu uživateľa na užívanie IGF-1 LR3 a IGF-1 DES. Peptidy ovplyvňujú ľudí rôznymi spôsobmi a opatrnosť je vždy nutná. Budúci výskum môže odhaliť rizikové faktory, ktoré v súčasnosti nie sú známe.